PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.H01143.1.p
Common NameLOC105976960, MIMGU_mgv1a010119mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family BBR-BPC
Protein Properties Length: 322aa    MW: 36117.8 Da    PI: 8.4697
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.H01143.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind300.65.9e-92632123301
         GAGA_bind  23 nlglq.lmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvensla.......salpvgvqvlsgtks 107
                       +lg++  m++ aerda+irern+al e+k a+aerdma lqrd+a+aern a+ erd+++++l ++e  ++         ++  ++ +sg++ 
  Migut.H01143.1.p   6 HLGIKtFMAITAERDAAIRERNMALEERKRAFAERDMAMLQRDAAIAERNSAIQERDEAIASLRFRESPMNhnstntnIPDSLVSELSSGARR 98 
                       566542688888***************************************************999988776655433222233455566666 PP

         GAGA_bind 108 idslqqlse..........pqledsavelreeeklealpieeaaeeake...kkkkkkrqrakkpkekkakkkkkksekskkkvkkesader. 186
                       i+  +q++           ++ ++++ + ++ +   +  ++ ++eea+e   ++k++++++ak+ k++k++++ k      ++ +k+   ++ 
  Migut.H01143.1.p  99 IQYQDQIRAvsepaaynnnNNNNNNSNNSQRGSLRGSSDVSITEEEASEtaaNNKPRRGRQAKDRKANKSQRVGK---RMAEELSKQIITNDw 188
                       666555443667777665422223333333333333444444444444400044444455555555555554444...333333333332224 PP

         GAGA_bind 187 ...................skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKm 260
                                          ++ ++k  +l+ln++++Des++PvPvC+CtGa++ CY+WGnGGWqSaCCtt+iS+yPLP+++++r +R++grKm
  Migut.H01143.1.p 189 snnnnnsnehdfesdeedkQQVSWK-DNLGLNQINFDESAMPVPVCTCTGAPQPCYRWGNGGWQSACCTTAISMYPLPQVANKRYSRVGGRKM 280
                       4567888999999999985555565.58***************************************************************** PP

         GAGA_bind 261 SqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                       S++af+klL++La+eGyd+s p+DLkdhWAkHGtn++ t++
  Migut.H01143.1.p 281 SGSAFSKLLNRLASEGYDFSAPLDLKDHWAKHGTNRYSTLK 321
                       *************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.5E-1021321IPR010409GAGA-binding transcriptional activator
PfamPF062175.8E-855321IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MDHNHHLGIK TFMAITAERD AAIRERNMAL EERKRAFAER DMAMLQRDAA IAERNSAIQE  60
RDEAIASLRF RESPMNHNST NTNIPDSLVS ELSSGARRIQ YQDQIRAVSE PAAYNNNNNN  120
NNNSNNSQRG SLRGSSDVSI TEEEASETAA NNKPRRGRQA KDRKANKSQR VGKRMAEELS  180
KQIITNDWSN NNNNSNEHDF ESDEEDKQQV SWKDNLGLNQ INFDESAMPV PVCTCTGAPQ  240
PCYRWGNGGW QSACCTTAIS MYPLPQVANK RYSRVGGRKM SGSAFSKLLN RLASEGYDFS  300
APLDLKDHWA KHGTNRYSTL K*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012857685.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_012857686.10.0PREDICTED: protein BASIC PENTACYSTEINE6-like
TrEMBLA0A022PVV90.0A0A022PVV9_ERYGU; Uncharacterized protein
STRINGSolyc02g084230.1.11e-121(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA80622230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38910.12e-72basic pentacysteine 5